All on Handling molecules
How can I create a simple molecule?
# create a system first
sys = System{Float32}() # this system will be of single precision, i.e., atom positions, velocities...
# as well as a molecule
h2o = Molecule(sys)
# create system atoms
o1 = Atom(h2o, 1, Elements.O)
h1 = Atom(h2o, 2, Elements.H)
h2 = Atom(h2o, 3, Elements.H)
# set positions of the atoms
# o1.r = [0, 0, 0] <-- this is the default value!
h1.r = [1, 0, 0]
h2.r = [cos(deg2rad(105)), sin(deg2rad(105)), 0]
# add bonds
Bond(h2o, o1.idx, h1.idx, BondOrder.Single)
Bond(h2o, o1.idx, h2.idx, BondOrder.Single)
println("Number of atoms: ", natoms(h2o))
println("Number of bonds: ", nbonds(h2o))Number of atoms: 3
Number of bonds: 2How can I determine the element of an atom (C, N, …)?
sys = load_pdb(ball_data_path("../test/data/AlaAla.pdb"))
for atom in atoms(sys)
println("Atom no.: $(atom.number), element: $(atom.element)")
endAtom no.: 1, element: N
Atom no.: 2, element: C
Atom no.: 3, element: C
Atom no.: 4, element: O
Atom no.: 5, element: H
Atom no.: 6, element: H
Atom no.: 7, element: H
Atom no.: 8, element: H
Atom no.: 9, element: H
Atom no.: 10, element: H
Atom no.: 11, element: C
Atom no.: 12, element: H
Atom no.: 13, element: N
Atom no.: 14, element: C
Atom no.: 15, element: C
Atom no.: 16, element: H
Atom no.: 17, element: H
Atom no.: 18, element: H
Atom no.: 19, element: H
Atom no.: 20, element: C
Atom no.: 21, element: H
Atom no.: 22, element: O
Atom no.: 23, element: OYou can also filter for specific elements:
c_atoms = filter(atom -> atom.element == Elements.C, atoms(sys))
for atom in c_atoms
println("Atom no.: $(atom.number), element: $(atom.element)")
endAtom no.: 2, element: C
Atom no.: 3, element: C
Atom no.: 11, element: C
Atom no.: 14, element: C
Atom no.: 15, element: C
Atom no.: 20, element: CHow can I identify backbone atoms?
sys = load_pdb(ball_data_path("../test/data/AlaAla.pdb"))
for atom in atoms(sys)
print(atom.element)
if atom.name in ["C", "O", "N", "HA"]
print(" <-- This is a backbone atom!")
end
println()
endN <-- This is a backbone atom!
C
C <-- This is a backbone atom!
O <-- This is a backbone atom!
H
H
H
H
H
H
C
H <-- This is a backbone atom!
N <-- This is a backbone atom!
C
C <-- This is a backbone atom!
H
H
H
H
C
H <-- This is a backbone atom!
O <-- This is a backbone atom!
OHow can I get the one-letter code out of a pdb file?
sys = load_pdb(ball_data_path("../test/data/2ptc.pdb"))
for chain in chains(sys)
# get all residues from the current chain
res = residues(chain).name
println("> Chain $(chain.name)")
println(join(one_letter_code.(res), ""))
end> Chain E
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAYGLEGKGDSCQGDSGGPVVCSGKLQGIVSWGSGCQAKNKPGVYTKVCNYVSWIKQTIASN
> Chain I
RPDFCLEPPYTGPCKARIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGAHow can I pick one single chain out of a system containing several chains?
This is often needed when a receptor and a ligand are co-complexed and you want to treat them separately.
sys = load_pdb(ball_data_path("../test/data/2ptc.pdb"))
all_chains = chains(sys)| # | idx | name |
|---|---|---|
| 1 | 2 | E |
| 2 | 349 | I |
ChainTable{Float32} with 2 rows:
This snippet will create separate PDB files for the two chains of the system:
write_pdb("2ptc_chainE.pdb", all_chains[1])
write_pdb("2ptc_chainI.pdb", all_chains[2])How can I map two configurations of the same protein onto each other?
# read in the first protein
sys = load_pdb(ball_data_path("../test/data/2ptc.pdb"))
mol = first(molecules(sys))
# we will generate a second version of the protein by moving it around
sys2 = deepcopy(sys)
mol2 = first(molecules(sys2))
translate!(mol2, Vector3{Float32}(2.0,1.0,2.0))
# let's see how far the structures are apart
println("RMSD before mapping:\t", compute_rmsd(mol2, mol))
# now we have two proteins or system we can map together
map_rigid!(mol2, mol)
# let's see how far the structures are apart afterwards
println("RMSD after mapping:\t", compute_rmsd(mol2, mol))RMSD before mapping: 3.0
RMSD after mapping: 3.881571e-6How can I remove water molecules from a system?
sys = load_pdb(ball_data_path("../test/data/1tgh.pdb"))
println("Number of atoms before removing water: ", natoms(sys))
# find all water fragments
ft = filter(frag -> frag.name == "HOH", fragments(sys))
# delete the found fragments, including all atoms and bonds
delete!(ft)
println("Number of atoms after removing water: ", natoms(sys))Number of atoms before removing water: 2355
Number of atoms after removing water: 2301